Lineage for d1m0sa1 (1m0s A:1-126,A:199-219)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496441Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 496442Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 496519Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
    share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits
  6. 496520Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)
  7. 496537Species Haemophilus influenzae [TaxId:727] [82391] (1 PDB entry)
  8. 496538Domain d1m0sa1: 1m0s A:1-126,A:199-219 [78351]
    Other proteins in same PDB: d1m0sa2, d1m0sb2

Details for d1m0sa1

PDB Entry: 1m0s (more details), 1.9 Å

PDB Description: northeast structural genomics consortium (nesg id ir21)

SCOP Domain Sequences for d1m0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae}
mnqlemkklaaqaalqyvkadrivgvgsgstvncfiealgtikdkiqgavaaskeseell
rkqgievfnandvssldiyvdgadeinpqkmmikgggaaltrekivaalakkficivdss
kqvdvlXfalrgadvvivgtpegakvid

SCOP Domain Coordinates for d1m0sa1:

Click to download the PDB-style file with coordinates for d1m0sa1.
(The format of our PDB-style files is described here.)

Timeline for d1m0sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0sa2