SCOP 1.67: Domain d1m0ib_: 1m0i B:

Lineage for d1m0ib_ (1m0i B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families)

5. Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)

6. Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
   forms dimer by swapping the common core elements

7. Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)

8. Domain d1m0ib_: 1m0i B: [78341]

Details for d1m0ib_

PDB Entry: 1m0i, 2.55 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site

SCOP Domain Sequences for d1m0ib_:

Sequence; same for both SEQRES and ATOM records:

>d1m0ib_ c.52.1.17 (B:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

Timeline for d1m0ib_:

• d1m0ib_ first appeared in SCOP 1.63
  
• d1m0ib_ appears in SCOP 1.65
  
• d1m0ib_ appears in SCOP 1.69
  
• d1m0ib_ appears in the current release, SCOPe 2.08