Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) |
Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein) |
Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species) forms dimer by swapping the common core elements |
Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries) |
Domain d1m0ia_: 1m0i A: [78340] |
PDB Entry: 1m0i (more details), 2.55 Å
SCOP Domain Sequences for d1m0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0ia_ c.52.1.17 (A:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7} sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke vpfdrlkrk
Timeline for d1m0ia_: