SCOP 1.67: Domain d1m0fb_: 1m0f B:

Lineage for d1m0fb_ (1m0f B:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein Bacteriophage alpha3 assembly [82950] (1 species)

7. Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry)

8. Domain d1m0fb_: 1m0f B: [78337]

Details for d1m0fb_

PDB Entry: 1m0f

PDB Description: structural studies of bacteriophage alpha3 assembly, cryo-electron microscopy

SCOP Domain Sequences for d1m0fb_:

Sequence; same for both SEQRES and ATOM records:

>d1m0fb_ i.6.1.1 (B:) Bacteriophage alpha3 assembly {Bacteriophage alpha3}
meqltknqrkkrdeieagksycsrrfggatcddksaqiyarfdkndwriqpaefyrfhda
evntfgyf

Timeline for d1m0fb_:

• d1m0fb_ first appeared in SCOP 1.63
  
• d1m0fb_ appears in SCOP 1.65
  
• d1m0fb_ appears in SCOP 1.69
  
• d1m0fb_ appears in the current release, SCOPe 2.08