| Class i: Low resolution protein structures [58117] (22 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins) |
| Protein Bacteriophage alpha3 assembly [82950] (1 species) |
| Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry) |
| Domain d1m0fb_: 1m0f B: [78337] |
PDB Entry: 1m0f (more details)
SCOP Domain Sequences for d1m0fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0fb_ i.6.1.1 (B:) Bacteriophage alpha3 assembly {Bacteriophage alpha3}
meqltknqrkkrdeieagksycsrrfggatcddksaqiyarfdkndwriqpaefyrfhda
evntfgyf
Timeline for d1m0fb_: