Lineage for d1m0f1_ (1m0f 1:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1469367Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1469368Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1469369Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1469370Protein Bacteriophage alpha3 assembly [82950] (1 species)
  7. 1469371Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry)
  8. 1469372Domain d1m0f1_: 1m0f 1: [78333]

Details for d1m0f1_

PDB Entry: 1m0f (more details), 16 Å

PDB Description: structural studies of bacteriophage alpha3 assembly, cryo-electron microscopy
PDB Compounds: (1:) Scaffolding protein D

SCOPe Domain Sequences for d1m0f1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0f1_ i.6.1.1 (1:) Bacteriophage alpha3 assembly {Bacteriophage alpha3 [TaxId: 10849]}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra

SCOPe Domain Coordinates for d1m0f1_:

Click to download the PDB-style file with coordinates for d1m0f1_.
(The format of our PDB-style files is described here.)

Timeline for d1m0f1_: