SCOPe 2.05: Domain d1m08b_: 1m08 B:

Lineage for d1m08b_ (1m08 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)

8. Domain d1m08b_: 1m08 B: [78331]
   complexed with po4, zn

Details for d1m08b_

PDB Entry: 1m08, 2.1 Å

PDB Description: crystal structure of the unbound nuclease domain of cole7

PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d1m08b_:

Sequence; same for both SEQRES and ATOM records:

>d1m08b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
mrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
pkrhidihrgk

Timeline for d1m08b_:

• d1m08b_ first appeared in SCOP 1.63
  
• d1m08b_ appears in SCOPe 2.04
  
• d1m08b_ appears in SCOPe 2.06
  
• d1m08b_ appears in the current release, SCOPe 2.08