Lineage for d1m08a_ (1m08 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498428Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 498429Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 498430Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 498431Protein DNase domain of colicin E7 [54062] (1 species)
  7. 498432Species Escherichia coli [TaxId:562] [54063] (5 PDB entries)
  8. 498435Domain d1m08a_: 1m08 A: [78330]

Details for d1m08a_

PDB Entry: 1m08 (more details), 2.1 Å

PDB Description: crystal structure of the unbound nuclease domain of cole7

SCOP Domain Sequences for d1m08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m08a_ d.4.1.1 (A:) DNase domain of colicin E7 {Escherichia coli}
mrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
pkrhidihrgk

SCOP Domain Coordinates for d1m08a_:

Click to download the PDB-style file with coordinates for d1m08a_.
(The format of our PDB-style files is described here.)

Timeline for d1m08a_: