Lineage for d1m07a_ (1m07 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324602Protein Amphibian cytotoxic ribonuclease [54084] (4 species)
  7. 324603Species Bullfrog (Rana catesbeiana) [TaxId:8400] [54085] (2 PDB entries)
  8. 324604Domain d1m07a_: 1m07 A: [78328]

Details for d1m07a_

PDB Entry: 1m07 (more details), 1.8 Å

PDB Description: residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)

SCOP Domain Sequences for d1m07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m07a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana)}
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp

SCOP Domain Coordinates for d1m07a_:

Click to download the PDB-style file with coordinates for d1m07a_.
(The format of our PDB-style files is described here.)

Timeline for d1m07a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m07b_