Lineage for d1m06g_ (1m06 G:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225199Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)
  6. 225200Protein Bacteriophage capsid proteins [49613] (3 species)
  7. 225201Species Bacteriophage alpha3 [TaxId:10849] [82008] (1 PDB entry)
  8. 225203Domain d1m06g_: 1m06 G: [78327]
    complexed with c

Details for d1m06g_

PDB Entry: 1m06 (more details), 3.5 Å

PDB Description: structural studies of bacteriophage alpha3 assembly, x-ray crystallography

SCOP Domain Sequences for d1m06g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m06g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage alpha3}
myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss
dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy
piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey
qvlqplk

SCOP Domain Coordinates for d1m06g_:

Click to download the PDB-style file with coordinates for d1m06g_.
(The format of our PDB-style files is described here.)

Timeline for d1m06g_: