Class b: All beta proteins [48724] (119 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein) |
Protein Bacteriophage capsid proteins [49613] (3 species) |
Species Bacteriophage alpha3 [TaxId:10849] [82008] (1 PDB entry) |
Domain d1m06g_: 1m06 G: [78327] complexed with c |
PDB Entry: 1m06 (more details), 3.5 Å
SCOP Domain Sequences for d1m06g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m06g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage alpha3} myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey qvlqplk
Timeline for d1m06g_: