![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.5: ssDNA viruses [88645] (4 families) ![]() |
![]() | Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) |
![]() | Domain d1m06g_: 1m06 G: [78327] Other proteins in same PDB: d1m06f_ protein/DNA complex |
PDB Entry: 1m06 (more details), 3.5 Å
SCOPe Domain Sequences for d1m06g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m06g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage alpha3 [TaxId: 10849]} myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey qvlqplk
Timeline for d1m06g_: