Lineage for d1m06g_ (1m06 G:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
Superfamily b.121.5: ssDNA viruses [88645] (4 families) 
Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) - Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
protein includes capsid protein F and spike protein G - Species Bacteriophage alpha3 [TaxId:10849] [419367] (2 PDB entries)
Domain d1m06g_: 1m06 G: [78327]
Other proteins in same PDB: d1m06f_
protein/DNA complex
Details for d1m06g_
PDB Entry: 1m06 (more details), 3.5 Å
PDB Description: structural studies of bacteriophage alpha3 assembly, x-ray crystallography
PDB Compounds: (G:) Major spike proteinSCOPe Domain Sequences for d1m06g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m06g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage alpha3 [TaxId: 10849]}
myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss
dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy
piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey
qvlqplk
SCOPe Domain Coordinates for d1m06g_:
Click to download the PDB-style file with coordinates for d1m06g_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m06g_:
- d1m06g_ first appeared in SCOP 1.63
- d1m06g_ appears in SCOPe 2.07
View in 3D
