![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.5: ssDNA viruses [88645] (4 families) ![]() |
![]() | Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) |
![]() | Protein Microvirus capsid proteins, capsid protein F [418932] (3 species) protein includes capsid protein F and spike protein G |
![]() | Species Bacteriophage alpha3 [TaxId:10849] [419366] (2 PDB entries) |
![]() | Domain d1m06f_: 1m06 F: [78326] Other proteins in same PDB: d1m06g_ protein/DNA complex has additional subdomain(s) that are not in the common domain |
PDB Entry: 1m06 (more details), 3.5 Å
SCOPe Domain Sequences for d1m06f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m06f_ b.121.5.1 (F:) Microvirus capsid proteins, capsid protein F {Bacteriophage alpha3 [TaxId: 10849]} reivdlshlafdcgmlgrlktvswtpviagdsfeldavgalrlsplrrglaidskvdfft fyiphrhvygdqwiqfmrdgvnaqplpsvtcnrypdhagyvgtivpannripkflhqsyl niynnyfrapwmperteanpsnlneddarygfrcchlkniwsaplppetklaeemgiesn sidimglqaayaqlhteqertyfmqryrdvissfggstsydadnrpllvmhtdfwasgyd vdgtdqsslgqfsgrvqqtfkhsvprffvpehgvmmtlalirfppisplehhylagksql tytdlagdpalignlppreisyrdlfrdgrsgikikvaesiwyrthpdyvnfkyhdlhgf pflddapgtstgdnlqeailvrhqdydacfqsqqllqwnkqarynvsvyrhmptvrdsim ts
Timeline for d1m06f_: