Lineage for d1m04a1 (1m04 A:151-506)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816656Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (5 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 816695Protein beta-N-acetylhexosaminidase [63915] (1 species)
  7. 816696Species Streptomyces plicatus [TaxId:1922] [63916] (6 PDB entries)
  8. 816699Domain d1m04a1: 1m04 A:151-506 [78324]
    Other proteins in same PDB: d1m04a2
    complexed with cl, gol, nag, so4; mutant

Details for d1m04a1

PDB Entry: 1m04 (more details), 1.95 Å

PDB Description: mutant streptomyces plicatus beta-hexosaminidase (d313n) in complex with product (glcnac)
PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOP Domain Sequences for d1m04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m04a1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggneahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt

SCOP Domain Coordinates for d1m04a1:

Click to download the PDB-style file with coordinates for d1m04a1.
(The format of our PDB-style files is described here.)

Timeline for d1m04a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m04a2