Lineage for d1m03a1 (1m03 A:151-506)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 572124Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (3 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 572145Protein beta-N-acetylhexosaminidase [63915] (1 species)
  7. 572146Species Streptomyces plicatus [TaxId:1922] [63916] (6 PDB entries)
  8. 572148Domain d1m03a1: 1m03 A:151-506 [78322]
    Other proteins in same PDB: d1m03a2
    complexed with cl, gol, nag, so4; mutant

Details for d1m03a1

PDB Entry: 1m03 (more details), 1.9 Å

PDB Description: mutant streptomyces plicatus beta-hexosaminidase (d313a) in complex with product (glcnac)

SCOP Domain Sequences for d1m03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m03a1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggaeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt

SCOP Domain Coordinates for d1m03a1:

Click to download the PDB-style file with coordinates for d1m03a1.
(The format of our PDB-style files is described here.)

Timeline for d1m03a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m03a2