SCOP 1.71: Domain d1m01a2: 1m01 A:8-150

Lineage for d1m01a2 (1m01 A:8-150)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
   family GH20

6. Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species)

7. Species Streptomyces plicatus [TaxId:1922] [64344] (6 PDB entries)

8. Domain d1m01a2: 1m01 A:8-150 [78321]
   Other proteins in same PDB: d1m01a1
   complexed with cl, gol, nag, so4

Details for d1m01a2

PDB Entry: 1m01, 2.1 Å

PDB Description: wildtype streptomyces plicatus beta-hexosaminidase in complex with product (glcnac)

SCOP Domain Sequences for d1m01a2:

Sequence; same for both SEQRES and ATOM records:

>d1m01a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr

Timeline for d1m01a2:

• d1m01a2 first appeared in SCOP 1.63
  
• d1m01a2 appears in SCOP 1.69
  
• d1m01a2 appears in SCOP 1.73
  
• d1m01a2 appears in the current release, SCOPe 2.08