Lineage for d1m01a2 (1m01 A:8-150)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 260262Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 260263Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (2 proteins)
    family GH20
  6. 260270Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species)
  7. 260271Species Streptomyces plicatus [TaxId:1922] [64344] (6 PDB entries)
  8. 260276Domain d1m01a2: 1m01 A:8-150 [78321]
    Other proteins in same PDB: d1m01a1
    complexed with cl, gol, nag, so4

Details for d1m01a2

PDB Entry: 1m01 (more details), 2.1 Å

PDB Description: wildtype streptomyces plicatus beta-hexosaminidase in complex with product (glcnac)

SCOP Domain Sequences for d1m01a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m01a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr

SCOP Domain Coordinates for d1m01a2:

Click to download the PDB-style file with coordinates for d1m01a2.
(The format of our PDB-style files is described here.)

Timeline for d1m01a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m01a1