Lineage for d1m01a1 (1m01 A:151-506)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (3 proteins)
Glycosyl hydrolase family 20, GH20Protein beta-N-acetylhexosaminidase [63915] (1 species) Species Streptomyces plicatus [TaxId:1922] [63916] (6 PDB entries) 
Domain d1m01a1: 1m01 A:151-506 [78320]
Other proteins in same PDB: d1m01a2
complexed with cl, gol, nag, so4
Details for d1m01a1
PDB Entry: 1m01 (more details), 2.1 Å
PDB Description: wildtype streptomyces plicatus beta-hexosaminidase in complex with product (glcnac)
SCOP Domain Sequences for d1m01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m01a1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggdeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt
SCOP Domain Coordinates for d1m01a1:
Click to download the PDB-style file with coordinates for d1m01a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m01a1:
- d1m01a1 first appeared in SCOP 1.63
- d1m01a1 appears in SCOP 1.67
- d1m01a1 appears in the current release, SCOPe 2.08
View in 3D
