SCOPe 2.02: Domain d1lzwa_: 1lzw A:

Lineage for d1lzwa_ (1lzw A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)

7. Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)

8. Domain d1lzwa_: 1lzw A: [78312]
   Other proteins in same PDB: d1lzwb_
   complex with ClpA N-domain
   complexed with pt

Details for d1lzwa_

PDB Entry: 1lzw, 2.5 Å

PDB Description: structural basis of clps-mediated switch in clpa substrate recognition

PDB Compounds: (A:) Protein yljA

SCOPe Domain Sequences for d1lzwa_:

Sequence; same for both SEQRES and ATOM records:

>d1lzwa_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka

Timeline for d1lzwa_:

• d1lzwa_ first appeared in SCOP 1.63
  
• d1lzwa_ appears in SCOPe 2.01
  
• d1lzwa_ appears in SCOPe 2.03
  
• d1lzwa_ appears in the current release, SCOPe 2.08