Lineage for d1lzoa_ (1lzo A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235646Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 235647Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 235648Protein Triosephosphate isomerase [51353] (15 species)
  7. 235717Species Plasmodium falciparum [51359] (5 PDB entries)
  8. 235725Domain d1lzoa_: 1lzo A: [78307]

Details for d1lzoa_

PDB Entry: 1lzo (more details), 2.8 Å

PDB Description: Plasmodium Falciparum Triosephosphate Isomerase-Phosphoglycolate Complex

SCOP Domain Sequences for d1lzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzoa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOP Domain Coordinates for d1lzoa_:

Click to download the PDB-style file with coordinates for d1lzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1lzoa_: