![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
![]() | Protein Triosephosphate isomerase [51353] (15 species) |
![]() | Species Plasmodium falciparum [51359] (5 PDB entries) |
![]() | Domain d1lyxa_: 1lyx A: [78304] complexed with pga |
PDB Entry: 1lyx (more details), 1.9 Å
SCOP Domain Sequences for d1lyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lyxa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum} rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd iiksam
Timeline for d1lyxa_: