Lineage for d1ly0a_ (1ly0 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555699Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 555700Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 555701Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 555709Protein Thaumatin [49876] (1 species)
  7. 555710Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (11 PDB entries)
  8. 555714Domain d1ly0a_: 1ly0 A: [78301]
    complexed with tar

Details for d1ly0a_

PDB Entry: 1ly0 (more details), 1.36 Å

PDB Description: Structure of thaumatin crystallized in the presence of glycerol

SCOP Domain Sequences for d1ly0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly0a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1ly0a_:

Click to download the PDB-style file with coordinates for d1ly0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly0a_: