Lineage for d1lxma3 (1lxm A:912-984)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387466Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2387467Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2387468Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 2387486Protein Hyaluronate lyase [49867] (2 species)
  7. 2387507Species Streptococcus agalactiae [TaxId:1311] [69232] (3 PDB entries)
  8. 2387510Domain d1lxma3: 1lxm A:912-984 [78298]
    Other proteins in same PDB: d1lxma1, d1lxma2, d1lxma4

Details for d1lxma3

PDB Entry: 1lxm (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with hexasaccharide unit of hyaluronan
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1lxma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxma3 b.24.1.1 (A:912-984) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
evellensskqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyy
qpqtmtktdqlai

SCOPe Domain Coordinates for d1lxma3:

Click to download the PDB-style file with coordinates for d1lxma3.
(The format of our PDB-style files is described here.)

Timeline for d1lxma3: