![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Hyaluronate lyase precatalytic domain [69167] (1 species) precedes the catalytic incomplete alpha5/alpha5 barrel a rudiment form of Ig-like domain |
![]() | Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries) |
![]() | Domain d1lxma2: 1lxm A:173-248 [78297] Other proteins in same PDB: d1lxma1, d1lxma3, d1lxma4 |
PDB Entry: 1lxm (more details), 2.2 Å
SCOPe Domain Sequences for d1lxma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxma2 b.1.18.2 (A:173-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]} hpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkisdk sgkiikevplsvtast
Timeline for d1lxma2: