Lineage for d1lxma2 (1lxm A:173-248)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789214Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
    precedes the catalytic incomplete alpha5/alpha5 barrel
    a rudiment form of Ig-like domain
  7. 789215Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries)
  8. 789217Domain d1lxma2: 1lxm A:173-248 [78297]
    Other proteins in same PDB: d1lxma1, d1lxma3, d1lxma4
    complexed with gcu, nag

Details for d1lxma2

PDB Entry: 1lxm (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with hexasaccharide unit of hyaluronan
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d1lxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxma2 b.1.18.2 (A:173-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]}
hpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkisdk
sgkiikevplsvtast

SCOP Domain Coordinates for d1lxma2:

Click to download the PDB-style file with coordinates for d1lxma2.
(The format of our PDB-style files is described here.)

Timeline for d1lxma2: