Lineage for d1lxga_ (1lxg A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342525Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulphide-rich fold: nearly all-beta
  4. 342526Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 342527Family g.7.1.1: Snake venom toxins [57303] (23 proteins)
  6. 342528Protein alpha-Cobratoxin [57318] (2 species)
  7. 342532Species Monocled cobra (Naja naja kaouthia) [TaxId:8649] [82899] (2 PDB entries)
    identical sequence to the Naja naja siamensis toxin
  8. 342534Domain d1lxga_: 1lxg A: [78294]
    complexed to a cognate peptide, chain B

Details for d1lxga_

PDB Entry: 1lxg (more details)

PDB Description: solution structure of alpha-cobratoxin complexed with a cognate peptide (structure ensemble)

SCOP Domain Sequences for d1lxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxga_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja naja kaouthia)}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

SCOP Domain Coordinates for d1lxga_:

Click to download the PDB-style file with coordinates for d1lxga_.
(The format of our PDB-style files is described here.)

Timeline for d1lxga_: