SCOPe 2.05: Domain d1lxea_: 1lxe A:

Lineage for d1lxea_ (1lxe A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.3: Cathelicidin motif [82592] (2 proteins)
   cathelin-like domain

6. Protein Cathelicidin motif of protegrin-3 [82593] (1 species)
   antimicrobial protein

7. Species Pig (Sus scrofa) [TaxId:9823] [82594] (5 PDB entries)

8. Domain d1lxea_: 1lxe A: [78291]
   swapped dimer

Details for d1lxea_

PDB Entry: 1lxe, 2.5 Å

PDB Description: crystal structure of the cathelicidin motif of protegrins

PDB Compounds: (A:) Protegrin-3 Precursor

SCOPe Domain Sequences for d1lxea_:

Sequence, based on SEQRES records:

>d1lxea_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa) [TaxId: 9823]}
alsyreavlravdrlneqsseanlyrlleldqppkadedpgtpkpvsftvketvcprptr
qppelcdfkengrvkqcvgtvtldqikdplditcnevq

Sequence, based on observed residues (ATOM records):

>d1lxea_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa) [TaxId: 9823]}
alsyreavlravdrlneqsseanlyrlleldqppkadedpgtpkpvsftvketvcprptr
qppelcdfkengrvkqcvgtvtldditcnevq

Timeline for d1lxea_:

• d1lxea_ first appeared in SCOP 1.63
  
• d1lxea_ appears in SCOPe 2.04
  
• d1lxea_ appears in SCOPe 2.06
  
• d1lxea_ appears in the current release, SCOPe 2.08