SCOP 1.63: Domain d1lwya1: 1lwy A:136-325

Lineage for d1lwya1 (1lwy A:136-325)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (4 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (7 PDB entries)

8. Domain d1lwya1: 1lwy A:136-325 [78285]
   Other proteins in same PDB: d1lwya2
   borohydride trapped intermediate
   complexed with ped

Details for d1lwya1

PDB Entry: 1lwy, 2.01 Å

PDB Description: hOgg1 Borohydride-Trapped Intermediate without 8-oxoguanine

SCOP Domain Sequences for d1lwya1:

Sequence; same for both SEQRES and ATOM records:

>d1lwya1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1lwya1:

• d1lwya1 is new in SCOP 1.63
  
• d1lwya1 appears in SCOP 1.65
  
• d1lwya1 appears in the current release, SCOPe 2.08