Class a: All alpha proteins [46456] (171 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (4 families) |
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) |
Protein 8-oxoguanine glycosylase [48160] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48161] (7 PDB entries) |
Domain d1lwya1: 1lwy A:136-325 [78285] Other proteins in same PDB: d1lwya2 borohydride trapped intermediate complexed with ped |
PDB Entry: 1lwy (more details), 2.01 Å
SCOP Domain Sequences for d1lwya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwya1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)} dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq avlfsadlrq
Timeline for d1lwya1: