Lineage for d1lwva2 (1lwv A:9-135)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733279Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 733391Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 733400Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 733401Species Human (Homo sapiens) [TaxId:9606] [55956] (23 PDB entries)
  8. 733414Domain d1lwva2: 1lwv A:9-135 [78282]
    Other proteins in same PDB: d1lwva1
    borohydride trapped intermediate
    complexed with ang, ca, ped

Details for d1lwva2

PDB Entry: 1lwv (more details), 2.3 Å

PDB Description: Borohydride-trapped hOgg1 Intermediate Structure Co-Crystallized with 8-aminoguanine
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOP Domain Sequences for d1lwva2:

Sequence, based on SEQRES records: (download)

>d1lwva2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d1lwva2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOP Domain Coordinates for d1lwva2:

Click to download the PDB-style file with coordinates for d1lwva2.
(The format of our PDB-style files is described here.)

Timeline for d1lwva2: