Lineage for d1lwta3 (1lwt A:299-415)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608385Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 608392Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 608447Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 608452Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 608453Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
  8. 608473Domain d1lwta3: 1lwt A:299-415 [78280]
    Other proteins in same PDB: d1lwta1
    complexed with mse

Details for d1lwta3

PDB Entry: 1lwt (more details), 3.2 Å

PDB Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its substrate DNA (Ca2+ free)

SCOP Domain Sequences for d1lwta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwta3 d.95.2.2 (A:299-415) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1lwta3:

Click to download the PDB-style file with coordinates for d1lwta3.
(The format of our PDB-style files is described here.)

Timeline for d1lwta3: