Lineage for d1lwta1 (1lwt A:1-180,A:416-454)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235167Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 235168Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 235173Family b.86.1.2: Intein (protein splicing domain) [51298] (3 proteins)
  6. 235180Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 235181Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (7 PDB entries)
  8. 235190Domain d1lwta1: 1lwt A:1-180,A:416-454 [78278]
    Other proteins in same PDB: d1lwta2, d1lwta3
    complexed with mse

Details for d1lwta1

PDB Entry: 1lwt (more details), 3.2 Å

PDB Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its substrate DNA (Ca2+ free)

SCOP Domain Sequences for d1lwta1:

Sequence, based on SEQRES records: (download)

>d1lwta1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1lwta1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
ssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivel
vkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXc
rgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

SCOP Domain Coordinates for d1lwta1:

Click to download the PDB-style file with coordinates for d1lwta1.
(The format of our PDB-style files is described here.)

Timeline for d1lwta1: