Lineage for d1lwsa3 (1lws A:299-415)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035823Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1035834Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 1035911Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 1035916Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 1035917Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
    Uniprot P17255 284-737
  8. 1035939Domain d1lwsa3: 1lws A:299-415 [78277]
    Other proteins in same PDB: d1lwsa1
    protein/DNA complex; complexed with ca

Details for d1lwsa3

PDB Entry: 1lws (more details), 3.5 Å

PDB Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its recognition sequence
PDB Compounds: (A:) endonuclease pi-scei

SCOPe Domain Sequences for d1lwsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwsa3 d.95.2.2 (A:299-415) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOPe Domain Coordinates for d1lwsa3:

Click to download the PDB-style file with coordinates for d1lwsa3.
(The format of our PDB-style files is described here.)

Timeline for d1lwsa3: