Lineage for d1lwea1 (1lwe A:430-554)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701998Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 701999Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 702026Domain d1lwea1: 1lwe A:430-554 [78267]
    Other proteins in same PDB: d1lwea2, d1lweb_
    complexed with csd, nvp, po4; mutant

Details for d1lwea1

PDB Entry: 1lwe (more details), 2.81 Å

PDB Description: crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
PDB Compounds: (A:) hiv-1 reverse transcriptase

SCOP Domain Sequences for d1lwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwea1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOP Domain Coordinates for d1lwea1:

Click to download the PDB-style file with coordinates for d1lwea1.
(The format of our PDB-style files is described here.)

Timeline for d1lwea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwea2
View in 3D
Domains from other chains:
(mouse over for more information)
d1lweb_