Lineage for d1lwdb_ (1lwd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138728Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 2138761Species Pig (Sus scrofa) [TaxId:9823] [82525] (2 PDB entries)
  8. 2138763Domain d1lwdb_: 1lwd B: [78266]
    complexed with ict, mn, so4

Details for d1lwdb_

PDB Entry: 1lwd (more details), 1.85 Å

PDB Description: crystal structure of nadp-dependent isocitrate dehydrogenase from porcine heart mitochondria
PDB Compounds: (B:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1lwdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwdb_ c.77.1.1 (B:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq

SCOPe Domain Coordinates for d1lwdb_:

Click to download the PDB-style file with coordinates for d1lwdb_.
(The format of our PDB-style files is described here.)

Timeline for d1lwdb_: