Lineage for d1lwda_ (1lwd A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320451Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 320452Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families) (S)
  5. 320453Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 320524Protein NADP-dependent isocitrate dehydrogenase [82524] (1 species)
  7. 320525Species Pig (Sus scrofa) [TaxId:9823] [82525] (1 PDB entry)
  8. 320526Domain d1lwda_: 1lwd A: [78265]

Details for d1lwda_

PDB Entry: 1lwd (more details), 1.85 Å

PDB Description: crystal structure of nadp-dependent isocitrate dehydrogenase from porcine heart mitochondria

SCOP Domain Sequences for d1lwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa)}
adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq

SCOP Domain Coordinates for d1lwda_:

Click to download the PDB-style file with coordinates for d1lwda_.
(The format of our PDB-style files is described here.)

Timeline for d1lwda_: