Lineage for d1lwca2 (1lwc A:4-429)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424541Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 424542Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 424543Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)
  8. 424575Domain d1lwca2: 1lwc A:4-429 [78263]
    Other proteins in same PDB: d1lwca1
    complexed with csd, nvp, po4; mutant

Details for d1lwca2

PDB Entry: 1lwc (more details), 2.62 Å

PDB Description: crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine

SCOP Domain Sequences for d1lwca2:

Sequence, based on SEQRES records: (download)

>d1lwca2 e.8.1.2 (A:4-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
vddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
ivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelel
aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
klwyql

Sequence, based on observed residues (ATOM records): (download)

>d1lwca2 e.8.1.2 (A:4-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfak
lvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkytaftip
sinnpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqyvddlyvgsdlei
gqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekdswtvn
diqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilkepvh
gvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqki
ttesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql

SCOP Domain Coordinates for d1lwca2:

Click to download the PDB-style file with coordinates for d1lwca2.
(The format of our PDB-style files is described here.)

Timeline for d1lwca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1lwcb_