Lineage for d1lw5d_ (1lw5 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 399760Family c.67.1.1: AAT-like [53384] (7 proteins)
  6. 399975Protein Low-specificity threonine aldolase [64123] (1 species)
  7. 399976Species Thermotoga maritima [TaxId:243274] [64124] (4 PDB entries)
  8. 399992Domain d1lw5d_: 1lw5 D: [78261]
    complexed with ca, cl, llp, mse, plg, plp

Details for d1lw5d_

PDB Entry: 1lw5 (more details), 2.05 Å

PDB Description: x-ray structure of l-threonine aldolase (low-specificity) in complex with glycine

SCOP Domain Sequences for d1lw5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lw5d_ c.67.1.1 (D:) Low-specificity threonine aldolase {Thermotoga maritima}
mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOP Domain Coordinates for d1lw5d_:

Click to download the PDB-style file with coordinates for d1lw5d_.
(The format of our PDB-style files is described here.)

Timeline for d1lw5d_: