Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) |
Family c.67.1.1: AAT-like [53384] (7 proteins) |
Protein Low-specificity threonine aldolase [64123] (1 species) |
Species Thermotoga maritima [TaxId:243274] [64124] (4 PDB entries) |
Domain d1lw5d_: 1lw5 D: [78261] complexed with ca, cl, llp, mse, plg, plp |
PDB Entry: 1lw5 (more details), 2.05 Å
SCOP Domain Sequences for d1lw5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw5d_ c.67.1.1 (D:) Low-specificity threonine aldolase {Thermotoga maritima} mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d1lw5d_: