SCOPe 2.01: Domain d1lw5b_: 1lw5 B:

Lineage for d1lw5b_ (1lw5 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Low-specificity threonine aldolase [64123] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)

8. Domain d1lw5b_: 1lw5 B: [78259]
   complexed with ca, cl, plg, plp

Details for d1lw5b_

PDB Entry: 1lw5, 2.05 Å

PDB Description: x-ray structure of l-threonine aldolase (low-specificity) in complex with glycine

PDB Compounds: (B:) L-allo-threonine aldolase

SCOPe Domain Sequences for d1lw5b_:

Sequence; same for both SEQRES and ATOM records:

>d1lw5b_ c.67.1.1 (B:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Timeline for d1lw5b_:

• d1lw5b_ first appeared in SCOP 1.63
  
• d1lw5b_ appears in SCOP 1.75
  
• d1lw5b_ appears in SCOPe 2.02
  
• d1lw5b_ appears in the current release, SCOPe 2.08