Lineage for d1lw5b_ (1lw5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895496Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 2895500Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)
  8. 2895518Domain d1lw5b_: 1lw5 B: [78259]
    Other proteins in same PDB: d1lw5d2
    complexed with ca, cl, plg, plp

Details for d1lw5b_

PDB Entry: 1lw5 (more details), 2.05 Å

PDB Description: x-ray structure of l-threonine aldolase (low-specificity) in complex with glycine
PDB Compounds: (B:) L-allo-threonine aldolase

SCOPe Domain Sequences for d1lw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lw5b_ c.67.1.1 (B:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOPe Domain Coordinates for d1lw5b_:

Click to download the PDB-style file with coordinates for d1lw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1lw5b_: