Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein Low-specificity threonine aldolase [64123] (2 species) |
Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries) |
Domain d1lw5b_: 1lw5 B: [78259] Other proteins in same PDB: d1lw5d2 complexed with ca, cl, plg, plp |
PDB Entry: 1lw5 (more details), 2.05 Å
SCOPe Domain Sequences for d1lw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw5b_ c.67.1.1 (B:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d1lw5b_:
View in 3D Domains from other chains: (mouse over for more information) d1lw5a_, d1lw5c_, d1lw5d1, d1lw5d2 |