Lineage for d1lvmb_ (1lvm B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671537Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 671581Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)
  7. 671582Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
  8. 671584Domain d1lvmb_: 1lvm B: [78244]
    complexed with ace; mutant

Details for d1lvmb_

PDB Entry: 1lvm (more details), 1.8 Å

PDB Description: catalytically active tobacco etch virus protease complexed with product
PDB Compounds: (B:) catalytic domain of the nuclear inclusion protein a (nia)

SCOP Domain Sequences for d1lvmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
slfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhg
vfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksms
smvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnftntnnyftsv
pknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp

SCOP Domain Coordinates for d1lvmb_:

Click to download the PDB-style file with coordinates for d1lvmb_.
(The format of our PDB-style files is described here.)

Timeline for d1lvmb_: