SCOP 1.69: Domain d1lvmb_: 1lvm B:

Lineage for d1lvmb_ (1lvm B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)

7. Species Tobacco etch virus, TEV [TaxId:12227] [82127] (2 PDB entries)

8. Domain d1lvmb_: 1lvm B: [78244]

Details for d1lvmb_

PDB Entry: 1lvm, 1.8 Å

PDB Description: catalytically active tobacco etch virus protease complexed with product

SCOP Domain Sequences for d1lvmb_:

Sequence; same for both SEQRES and ATOM records:

>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV}
slfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhg
vfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksms
smvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnftntnnyftsv
pknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp

Timeline for d1lvmb_:

• d1lvmb_ first appeared in SCOP 1.63
  
• d1lvmb_ appears in SCOP 1.67
  
• d1lvmb_ appears in SCOP 1.71
  
• d1lvmb_ appears in the current release, SCOPe 2.08