Lineage for d1lvmb_ (1lvm B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)
  7. Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
    Uniprot P04517 2041-2279
  8. Domain d1lvmb_: 1lvm B: [78244]

Details for d1lvmb_

PDB Entry: 1lvm (more details), 1.8 Å

PDB Description: catalytically active tobacco etch virus protease complexed with product
PDB Compounds: (B:) catalytic domain of the nuclear inclusion protein a (nia)

SCOPe Domain Sequences for d1lvmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
slfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhg
vfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksms
smvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnftntnnyftsv
pknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp

SCOPe Domain Coordinates for d1lvmb_ are not available.

Timeline for d1lvmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lvm.1, d1lvm.1