Lineage for d1lvm.1 (1lvm A:,E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795140Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1795188Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)
  7. 1795189Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
    Uniprot P04517 2041-2279
  8. 1795190Domain d1lvm.1: 1lvm A:,E: [78243]

Details for d1lvm.1

PDB Entry: 1lvm (more details), 1.8 Å

PDB Description: catalytically active tobacco etch virus protease complexed with product
PDB Compounds: (A:) catalytic domain of the nuclear inclusion protein a (nia), (E:) catalytic domain of the nuclear inclusion protein a (nia)

SCOPe Domain Sequences for d1lvm.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lvm.1 b.47.1.3 (A:,E:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn
gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv
ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf
tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkpXeatqlmn

SCOPe Domain Coordinates for d1lvm.1:

Click to download the PDB-style file with coordinates for d1lvm.1.
(The format of our PDB-style files is described here.)

Timeline for d1lvm.1: