SCOP 1.73: Domain d1lvga_: 1lvg A:

Lineage for d1lvga_ (1lvg A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82393] (1 PDB entry)

8. Domain d1lvga_: 1lvg A: [78242]
   complexed with 5gp, adp, k

Details for d1lvga_

PDB Entry: 1lvg, 2.1 Å

PDB Description: crystal structure of mouse guanylate kinase in complex with gmp and adp

PDB Compounds: (A:) Guanylate kinase

SCOP Domain Sequences for d1lvga_:

Sequence; same for both SEQRES and ATOM records:

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}
rpvvlsgpsgagkstllkklfqehssifgfsvshttrnprpgeedgkdyyfvtremmqrd
iaagdfiehaefsgnlygtskeavravqamnricvldvdlqgvrsikktdlcpiyifvqp
psldvleqrlrlrnteteeslakrlaaartdmesskepglfdlviinddldkayatlkqa
lseeikkaqg

Timeline for d1lvga_:

• d1lvga_ first appeared in SCOP 1.63
  
• d1lvga_ appears in SCOP 1.71
  
• d1lvga_ appears in SCOP 1.75
  
• d1lvga_ appears in the current release, SCOPe 2.08