Lineage for d1lvga_ (1lvg A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313182Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 313287Protein Guanylate kinase [52542] (2 species)
  7. 313293Species Mouse (Mus musculus) [TaxId:10090] [82393] (1 PDB entry)
  8. 313294Domain d1lvga_: 1lvg A: [78242]
    complexed with 5gp, adp, k

Details for d1lvga_

PDB Entry: 1lvg (more details), 2.1 Å

PDB Description: crystal structure of mouse guanylate kinase in complex with gmp and adp

SCOP Domain Sequences for d1lvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus)}
rpvvlsgpsgagkstllkklfqehssifgfsvshttrnprpgeedgkdyyfvtremmqrd
iaagdfiehaefsgnlygtskeavravqamnricvldvdlqgvrsikktdlcpiyifvqp
psldvleqrlrlrnteteeslakrlaaartdmesskepglfdlviinddldkayatlkqa
lseeikkaqg

SCOP Domain Coordinates for d1lvga_:

Click to download the PDB-style file with coordinates for d1lvga_.
(The format of our PDB-style files is described here.)

Timeline for d1lvga_: