Lineage for d1lvca_ (1lvc A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 425356Fold e.41: Adenylylcyclase toxin (the edema factor) [81299] (1 superfamily)
    3 domains: (1&2) alpha+beta, with domain 2 being inserted in domain 1; (3) all-alpha
  4. 425357Superfamily e.41.1: Adenylylcyclase toxin (the edema factor) [81298] (1 family) (S)
    Domain 1 has topological and active site similarity to the Nucleotidyltransferases (eg. 1kny N-domain); domain 3 binds calmodulin
  5. 425358Family e.41.1.1: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
    decorated with many insertions and the C-terminal domain
  6. 425359Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 425360Species Bacillus anthracis [TaxId:1392] [69889] (6 PDB entries)
  8. 425374Domain d1lvca_: 1lvc A: [78236]
    Other proteins in same PDB: d1lvcd_, d1lvce_, d1lvcf_

Details for d1lvca_

PDB Entry: 1lvc (more details), 3.6 Å

PDB Description: crystal structure of the adenylyl cyclase domain of anthrax edema factor (ef) in complex with calmodulin and 2' deoxy, 3' anthraniloyl atp

SCOP Domain Sequences for d1lvca_:

Sequence, based on SEQRES records: (download)

>d1lvca_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksni
efkllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1lvca_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrsssvkkiagylsdyynsanhifsqekkrkisifrgiqay
neienvlkskqiapeyknyfqylkeritnqvqlllthqkfkllykqlnftenetdnfevf
qkiid

SCOP Domain Coordinates for d1lvca_:

Click to download the PDB-style file with coordinates for d1lvca_.
(The format of our PDB-style files is described here.)

Timeline for d1lvca_: