Lineage for d1lvbb_ (1lvb B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 562627Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 562668Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)
  7. 562669Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
  8. 562673Domain d1lvbb_: 1lvb B: [78235]
    complexed with gol, mse; mutant

Details for d1lvbb_

PDB Entry: 1lvb (more details), 2.2 Å

PDB Description: catalytically inactive tobacco etch virus protease complexed with substrate

SCOP Domain Sequences for d1lvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvbb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV}
prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
elltnqeaqqwvsgwrlnadsvlwgghkvfmskp

SCOP Domain Coordinates for d1lvbb_:

Click to download the PDB-style file with coordinates for d1lvbb_.
(The format of our PDB-style files is described here.)

Timeline for d1lvbb_: