SCOP 1.67: Domain d1lvbb_: 1lvb B:

Lineage for d1lvbb_ (1lvb B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)

7. Species Tobacco etch virus, TEV [TaxId:12227] [82127] (2 PDB entries)

8. Domain d1lvbb_: 1lvb B: [78235]
   complexed with gol, mse; mutant

Details for d1lvbb_

PDB Entry: 1lvb, 2.2 Å

PDB Description: catalytically inactive tobacco etch virus protease complexed with substrate

SCOP Domain Sequences for d1lvbb_:

Sequence; same for both SEQRES and ATOM records:

>d1lvbb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV}
prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
elltnqeaqqwvsgwrlnadsvlwgghkvfmskp

Timeline for d1lvbb_:

• d1lvbb_ first appeared in SCOP 1.63
  
• d1lvbb_ appears in SCOP 1.65
  
• d1lvbb_ appears in SCOP 1.69
  
• d1lvbb_ appears in the current release, SCOPe 2.08