| Class b: All beta proteins [48724] (177 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
| Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species) |
| Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries) Uniprot P04517 2041-2279 |
| Domain d1lvba_: 1lvb A: [78234] complexed with gol |
PDB Entry: 1lvb (more details), 2.2 Å
SCOPe Domain Sequences for d1lvba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvba_ b.47.1.3 (A:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
elltnqeaqqwvsgwrlnadsvlwgghkvfmskp
Timeline for d1lvba_: