SCOPe 2.06: Domain d1lvba_: 1lvb A:

Lineage for d1lvba_ (1lvb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species)

7. Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries)
   Uniprot P04517 2041-2279

8. Domain d1lvba_: 1lvb A: [78234]
   complexed with gol

Details for d1lvba_

PDB Entry: 1lvb, 2.2 Å

PDB Description: catalytically inactive tobacco etch virus protease complexed with substrate

PDB Compounds: (A:) catalytic domain of the nuclear inclusion protein a (nia)

SCOPe Domain Sequences for d1lvba_:

Sequence; same for both SEQRES and ATOM records:

>d1lvba_ b.47.1.3 (A:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}
prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
elltnqeaqqwvsgwrlnadsvlwgghkvfmskp

Timeline for d1lvba_:

• d1lvba_ first appeared in SCOP 1.63
  
• d1lvba_ appears in SCOPe 2.05
  
• d1lvba_ appears in SCOPe 2.07
  
• d1lvba_ appears in the current release, SCOPe 2.08