Lineage for d1lv9a_ (1lv9 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498854Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 498855Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 498856Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 498909Protein IP-10/CXCL10 [82573] (1 species)
  7. 498910Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 498919Domain d1lv9a_: 1lv9 A: [78233]

Details for d1lv9a_

PDB Entry: 1lv9 (more details)

PDB Description: cxcr3 binding chemokine ip-10/cxcl10

SCOP Domain Sequences for d1lv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lv9a_ d.9.1.1 (A:) IP-10/CXCL10 {Human (Homo sapiens)}
vrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllk
avsk

SCOP Domain Coordinates for d1lv9a_:

Click to download the PDB-style file with coordinates for d1lv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1lv9a_: