SCOPe 2.03: Domain d1lv7a_: 1lv7 A:

Lineage for d1lv7a_ (1lv7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (3 species)
   ATP-dependent protease

7. Species Escherichia coli [TaxId:562] [82419] (1 PDB entry)

8. Domain d1lv7a_: 1lv7 A: [78232]
   complexed with so4

Details for d1lv7a_

PDB Entry: 1lv7, 1.5 Å

PDB Description: Crystal Structure of the AAA domain of FtsH

PDB Compounds: (A:) FtsH

SCOPe Domain Sequences for d1lv7a_:

Sequence, based on SEQRES records:

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}
mltedqikttfadvagcdeakeevaelveylrepsrfqklggkipkgvlmvgppgtgktl
lakaiageakvpfftisgsdfvemfvgvgasrvrdmfeqakkaapciifideidavgrqr
gaglggghdereqtlnqmlvemdgfegnegiiviaatnrpdvldpallrpgrfdrqvvvg
lpdvrgreqilkvhmrrvplapdidaaiiargtpgfsgadlanlvneaalfaargnkrvv
smvefekakdkimmgl

Sequence, based on observed residues (ATOM records):

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}
mltedqikttfadvagcdeakeevaelveylrepsrfkipkgvlmvgppgtgktllakai
ageakvpfftisgsdfvemfvgvgasrvrdmfeqakkaapciifideidavgrqrgaglg
gghdereqtlnqmlvemdgfegnegiiviaatnrpdvldpallrpgrfdrqvvvglpdvr
greqilkvhmrrvplapdidaaiiargtpgfsgadlanlvneaalfaargnkrvvsmvef
ekakdkimmgl

Timeline for d1lv7a_:

• d1lv7a_ first appeared in SCOP 1.63
  
• d1lv7a_ appears in SCOPe 2.02
  
• d1lv7a_ appears in SCOPe 2.04
  
• d1lv7a_ appears in the current release, SCOPe 2.08