Lineage for d1lv7a_ (1lv7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113457Protein AAA domain of cell division protein FtsH [82418] (3 species)
    ATP-dependent protease
  7. 2113458Species Escherichia coli [TaxId:562] [82419] (1 PDB entry)
  8. 2113459Domain d1lv7a_: 1lv7 A: [78232]
    complexed with so4

Details for d1lv7a_

PDB Entry: 1lv7 (more details), 1.5 Å

PDB Description: Crystal Structure of the AAA domain of FtsH
PDB Compounds: (A:) FtsH

SCOPe Domain Sequences for d1lv7a_:

Sequence, based on SEQRES records: (download)

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}
mltedqikttfadvagcdeakeevaelveylrepsrfqklggkipkgvlmvgppgtgktl
lakaiageakvpfftisgsdfvemfvgvgasrvrdmfeqakkaapciifideidavgrqr
gaglggghdereqtlnqmlvemdgfegnegiiviaatnrpdvldpallrpgrfdrqvvvg
lpdvrgreqilkvhmrrvplapdidaaiiargtpgfsgadlanlvneaalfaargnkrvv
smvefekakdkimmgl

Sequence, based on observed residues (ATOM records): (download)

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}
mltedqikttfadvagcdeakeevaelveylrepsrfkipkgvlmvgppgtgktllakai
ageakvpfftisgsdfvemfvgvgasrvrdmfeqakkaapciifideidavgrqrgaglg
gghdereqtlnqmlvemdgfegnegiiviaatnrpdvldpallrpgrfdrqvvvglpdvr
greqilkvhmrrvplapdidaaiiargtpgfsgadlanlvneaalfaargnkrvvsmvef
ekakdkimmgl

SCOPe Domain Coordinates for d1lv7a_:

Click to download the PDB-style file with coordinates for d1lv7a_.
(The format of our PDB-style files is described here.)

Timeline for d1lv7a_: